HPA024360

USH1G antibody from Sigma-Aldrich
ANKS4A, FLJ33924, Sans
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024360
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024360, RRID:AB_1858660
Product name
Anti-USH1G antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024360
Antibody type
Polyclonal
Antigen
Usher syndrome type-1G protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NIWCLDNDYHTPLDMAAMKGHMECVRYLDSIAAKQ
SSLNPKLVGKLKDKAFREAERRIRECAKLQRRHHE
RMER
Storage
-20C
Provider Type Product Number
- No reagents -