Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184253 - Provider product page

- Provider
- antibodies-online
- Product name
- anti-Cholinergic Receptor, Nicotinic, alpha 1 (Muscle) (CHRNA1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the C terminal of human CHRNA1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
STHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQD
KKIFT EDIDISDISG- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Mutation in the AChR ion channel gate underlies a fast channel congenital myasthenic syndrome.
Webster R, Brydson M, Croxen R, Newsom-Davis J, Vincent A, Beeson D
Neurology 2004 Apr 13;62(7):1090-6
Neurology 2004 Apr 13;62(7):1090-6
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Western Blotting
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image

- Experimental details
- Image(s): Immunohistochemistry