Antibody data

Product number
H00027329-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027329-M01, RRID:AB_1203956
Product name
ANGPTL3 monoclonal antibody (M01), clone 3B7
Provider product page
Abnova Corporation - H00027329-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant ANGPTL3.
Antigen sequence
SRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLL
QLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLS
LQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELN
SKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETP
EHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQ
QHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTT
PFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYA
IRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFN
ETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVL
RIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAIT
GNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGG
WWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKS
QNGRLYSIKSTKMLIHPTDSESFE
Isotype
IgG
Antibody clone number
3B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -