Antibody data

Product number
H00027329-M10
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00027329-M10, RRID:AB_1571185
Product name
ANGPTL3 monoclonal antibody (M10), clone 3F11
Provider product page
Abnova Corporation - H00027329-M10
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant ANGPTL3.
Antigen sequence
HLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCP
EGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRR
GLSWKSQNGRLYSIKSTKMLIHPTDSESFE
Isotype
IgG
Antibody clone number
3F11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -