Antibody data

Product number
H00022924-M08
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022924-M08, RRID:AB_1237775
Product name
MAPRE3 monoclonal antibody (M08), clone 3D7
Provider product page
Abnova Corporation - H00022924-M08
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MAPRE3.
Antigen sequence
NPLLARQGQDVAPPPNPGDQIFNKSKKLIGTAVPQ
RTSPTGPKNMQTSGRLSNVAPPCILRKNPPSARNG
GHETDAQILELNQQLVDLKLTVDG
Isotype
IgG
Antibody clone number
3D7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -