HPA009263

MAPRE3 antibody from Sigma-Aldrich
EB3, RP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009263
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009263, RRID:AB_1078716
Product name
Anti-MAPRE3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009263
Antibody type
Polyclonal
Antigen
Microtubule-associated protein RP/EB family member 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YDGKDYNPLLARQGQDVAPPPNPGDQIFNKSKKLI
GTAVPQRTSPTGPKNMQTSGRLSNVAPPCILRKNP
PSARNGGHETDAQILELNQQLVDLKLTVDGLEKER
DFYFSKLR
Storage
-20C
Provider Type Product Number
- No reagents -