HPA022015

CDR2L antibody from Sigma-Aldrich
HUMPPA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022015
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022015, RRID:AB_1846462
Product name
Anti-CDR2L antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022015
Antibody type
Polyclonal
Antigen
Cerebellar degeneration-related protein 2-like recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRL
EQSQPEYKALFKEIFSRIQKTKADINATKVKTHSS
Storage
-20C
Provider Type Product Number
- No reagents -