HPA024229

ARMC7 antibody from Sigma-Aldrich
FLJ22160
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024229
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024229, RRID:AB_2059152
Product name
Anti-ARMC7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024229
Antibody type
Polyclonal
Antigen
Armadillo repeat-containing protein 7 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MAQKPKVDPHVGRLGYLQALVTEFQETQSQDAKEQ
VLANLANFAYDPSNYEYLRQLQVLDLFLDSLSEEN
ETLVEFAIGGLCNLCPDRANKEHILHAGG
Storage
-20C
Provider Type Product Number
- No reagents -