HPA009160

NDFIP2 antibody from Sigma-Aldrich
KIAA1165, N4wbp5a
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009160
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009160, RRID:AB_1079456
Product name
Anti-NDFIP2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009160
Antibody type
Polyclonal
Antigen
NEDD4 family-interacting protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AAAGATGSEELPPGDRGCRNGGGRGPAATTSSTGV
AVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVL
LNEEDN
Storage
-20C
Provider Type Product Number
- No reagents -