HPA023632

NT5C antibody from Sigma-Aldrich
cdN, DNT-1, DNT1, PN-I, UMPH2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023632
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA023632, RRID:AB_1854662
Product name
Anti-NT5C antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA023632
Antibody type
Polyclonal
Antigen
5' recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLARE
QYRALRPDLADKVASVYEAPGFFLDLEPIP
Storage
-20C
Provider Type Product Number
- No reagents -