PAB20480

OAZ1 antibody from Abnova Corporation
AZ1, AZI, MGC138338, OAZ

Antibody data

Product number
PAB20480
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20480, RRID:AB_10963110
Product name
OAZ1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20480
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant OAZ1.
Antigen sequence
QSRLTDAKRINWRTVLSGGSLYIEIPGGALPEGSK
DSFAVLLEFAEEQLRADHVFICFHKNREDRAALLR
TFSFLGFEIVRPGHPLVPKRPDACFMAYTFERESS
GEEEE
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -