HPA009291

OAZ1 antibody from Sigma-Aldrich
AZI, MGC138338, OAZ
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009291
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009291, RRID:AB_1079519
Product name
Anti-OAZ1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009291
Antibody type
Polyclonal
Antigen
Ornithine decarboxylase antizyme recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSRLTDAKRINWRTVLSGGSLYIEIPGGALPEGSK
DSFAVLLEFAEEQLRADHVFICFHKNREDRAALLR
TFSFLGFEIVRPGHPLVPKRPDACFMAYTFERESS
GEEEE
Storage
-20C
Provider Type Product Number
- No reagents -