Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunocytochemistry [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA028825 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA028825, RRID:AB_10602130
- Product name
- Anti-FABP7
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
MVEAFCATWKLTNSQNFDEYMKALGVGFATRQVGN
VTKPTVIISQEGDKVVIRTLSTFKNTEISFQLGEE
FDETTADDRNCK- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references FABP7 and HMGCS2 are novel protein markers for apocrine differentiation categorizing apocrine carcinoma of the breast.
Impact of Gender in Renal Cell Carcinoma: The Relationship of FABP7 and BRN2 Expression with Overall Survival.
Gromov P, Espinoza JA, Talman ML, Honma N, Kroman N, Timmermans Wielenga V, Moreira JM, Gromova I
PloS one 2014;9(11):e112024
PloS one 2014;9(11):e112024
Impact of Gender in Renal Cell Carcinoma: The Relationship of FABP7 and BRN2 Expression with Overall Survival.
Tan C, Takayama T, Takaoka N, Fujita H, Miyazaki M, Sugiyama T, Ozono S
Clinical Medicine Insights. Oncology 2014;8:21-7
Clinical Medicine Insights. Oncology 2014;8:21-7
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & cytosol.
Enhanced validation
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Enhanced method
- Orthogonal validation
- Main image
- Experimental details
- Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-FABP7 antibody. Corresponding FABP7 RNA-seq data are presented for the same tissues.
- Sample type
- HUMAN
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human hippocampus shows strong cytoplasmic and nuclear positivity in subsets of glial cells.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human cerebral cortex shows high expression.
- Sample type
- HUMAN
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human pancreas shows low expression as expected.
- Sample type
- HUMAN