HPA009269

LHPP antibody from Atlas Antibodies
HDHD2B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA009269
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA009269, RRID:AB_1079249
Product name
Anti-LHPP
Provider product page
Atlas Antibodies - HPA009269
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SGVLYDSGAGGGTAIAGSVEAVARLKRSRLKVRFC
TNESQKSRAELVGQLQRLGFDISEQEVTAPAPAAC
QILKERGLRPYLLIHDGVRSEFDQIDTSNPNCVVI
ADAGE
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -