HPA009163

LHPP antibody from Sigma-Aldrich
HDHD2B
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009163
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009163, RRID:AB_1079250
Product name
Anti-LHPP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009163
Antibody type
Polyclonal
Antigen
Phospholysine phosphohistidine inorganic pyrophosphate phosphatase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LISLGKGRYYKETSGLMLDVGPYMKALEYACGIKA
EVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGD
VGGAQRCGMRALQVRTGKFRPSDEHHPEVKADGYV
D
Storage
-20C
Provider Type Product Number
- No reagents -