HPA070349

HOXD4 antibody from Atlas Antibodies
HOX4, HOX4B
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA070349
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA070349, RRID:AB_2686258
Product name
Anti-HOXD4
Provider product page
Atlas Antibodies - HPA070349
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
ARAYSQSDPKQPPSGTALKQPAVVYPWMKKV
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -