Antibody data

Product number
ABIN183759
Provider
antibodies-online
Product name
anti-Homeobox D4 (HOXD4) (C-Term) antibody
Provider product page
antibodies-online - ABIN183759
Antibody type
Polyclonal
Antigen
The immunogen for anti-HOXD4 antibody: synthetic peptide directed towards the C terminal of human HOXD4
Description
Protein A purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
RMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQH
LQPMA KDHHTDLTTL
Epitope
C-Term
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -