HPA021660

UBE2U antibody from Sigma-Aldrich
MGC35130
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA021660
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA021660, RRID:AB_1858550
Product name
Anti-UBE2U antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA021660
Antibody type
Polyclonal
Antigen
Ubiquitin-conjugating enzyme E2 U recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MHGRAYLLLHRDFCDLKENNYKGITAKPVSEDMME
WEVEIEGLQNSVWQGLVFQLTIHFTSEYNYAPPVV
KFITIPF
Storage
-20C
Provider Type Product Number
- No reagents -