HPA009164

SHOC2 antibody from Sigma-Aldrich
KIAA0862, SOC-2, SOC2, SUR-8, SUR8
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA009164
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA009164, RRID:AB_1079960
Product name
Anti-SHOC2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA009164
Antibody type
Polyclonal
Antigen
Leucine-rich repeat protein SHOC-2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LEENKLESLPNEIAYLKDLQKLVLTNNQLTTLPRG
IGHLTNLTHLGLGENLLTHLPEEIGTLENLEELYL
NDNPNLHSLPFELALCSKLSIMSIENCPLSHLPPQ
IVA
Storage
-20C
Provider Type Product Number
- No reagents -