HPA023007

MRPS7 antibody from Atlas Antibodies
MRP-S, RP-S7, RPMS7
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA023007
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA023007, RRID:AB_1854132
Product name
Anti-MRPS7
Provider product page
Atlas Antibodies - HPA023007
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LKGGRFYQVPVPLPDRRRRFLAMKWMITECRDKKH
QRTLMPEKLSHKLLEAFHNQGPVIKRKHDLHKMAE
ANRALAHYRWW
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -