HPA022522

MRPS7 antibody from Sigma-Aldrich
MRP-S, RP-S7, RPMS7
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022522
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022522, RRID:AB_1854131
Product name
Anti-MRPS7 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022522
Antibody type
Polyclonal
Antigen
28S ribosomal protein S7, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSSVFEDPVISKFTNMMMIGGNKVLARSLMIQTLE
AVKRKQFEKYHAASAEEQATIERNPYTIFHQALKN
CEPMIGLVPI
Storage
-20C
Provider Type Product Number
- No reagents -