HPA028860

ZNF84 antibody from Atlas Antibodies
HPF2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA028860
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA028860, RRID:AB_10604102
Product name
Anti-ZNF84
Provider product page
Atlas Antibodies - HPA028860
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SLGYEVMKPDVIFKLEQGEEPWVGDGEIPSSDSPE
VWKVDGNMMWHQDNQDKLKIIKRGHECDAFGKNFN
LNMNFVPLRKSNSEGDLDGLILKHHLDLLIPKGDY
GKAESDDFNVFDNFFLHSKPEDTDTWLKYYDCDKY
KES
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -