Antibody data

Product number
ABIN183202
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 84 (ZNF84) antibody
Provider product page
antibodies-online - ABIN183202
Antibody type
Polyclonal
Antigen
The immunogen for anti-ZNF84 antibody: synthetic peptide directed towards the C terminal of human ZNF84
Reactivity
Human, Mouse, Rat, Xenopus
Host
Rabbit
Antigen sequence
RKAFSQKSQLVNHQRIHTGEKPYRCIECGKAFSQK
SQLIN HQRTHTVKKS
Vial size
0.1 mg
Provider Type Product Number
- No reagents -