AV35668

ZNF84 antibody from Sigma-Aldrich
HPF2
Immunohistochemistry
Recommended by provider

Antibody data

Product number
AV35668
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV35668, RRID:AB_1859467
Product name
Anti-ZNF84 antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV35668
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human ZNF84 with an internal ID of P06914
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
RKAFSQKSQLVNHQRIHTGEKPYRCIECGKAFSQK
SQLINHQRTHTVKKS
Storage
-20C
Provider Type Product Number
- No reagents -