ABIN184093

HNRNPA3 antibody from antibodies-online
HNRPA3
Western blot
Recommended by provider
Immunohistochemistry
Data presented on provider website

Antibody data

Product number
ABIN184093
Provider
antibodies-online
Product name
anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody
Provider product page
antibodies-online - ABIN184093
Antibody type
Polyclonal
Antigen
The immunogen for anti-HNRPA3 antibody: synthetic peptide directed towards the N terminal of human HNRPA3
Description
Protein A purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLR
KLFIG GLSFETTDDS
Epitope
N-Term
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -