Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN184093 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Heterogeneous Nuclear Ribonucleoprotein A3 (HNRNPA3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-HNRPA3 antibody: synthetic peptide directed towards the N terminal of human HNRPA3
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine
- Host
- Rabbit
- Antigen sequence
MEVKPPPGRPQPDSGRRRRRRGEEGHDPKEPEQLR
KLFIG GLSFETTDDS- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Extensive association of HuR with hnRNP proteins within immunoselected hnRNP and mRNP complexes.
Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France.
Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
Papadopoulou C, Patrinou-Georgoula M, Guialis A
Biochimica et biophysica acta 2010 Apr;1804(4):692-703
Biochimica et biophysica acta 2010 Apr;1804(4):692-703
Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France.
Lazrek M, Goffard A, Schanen C, Karquel C, Bocket L, Lion G, Devaux M, Hedouin V, Gosset D, Hober D
Diagnostic microbiology and infectious disease 2006 May;55(1):55-8
Diagnostic microbiology and infectious disease 2006 May;55(1):55-8
Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
Kimura K, Wakamatsu A, Suzuki Y, Ota T, Nishikawa T, Yamashita R, Yamamoto J, Sekine M, Tsuritani K, Wakaguri H, Ishii S, Sugiyama T, Saito K, Isono Y, Irie R, Kushida N, Yoneyama T, Otsuka R, Kanda K, Yokoi T, Kondo H, Wagatsuma M, Murakawa K, Ishida S, Ishibashi T, Takahashi-Fujii A, Tanase T, Nagai K, Kikuchi H, Nakai K, Isogai T, Sugano S
Genome research 2006 Jan;16(1):55-65
Genome research 2006 Jan;16(1):55-65
No comments: Submit comment
No validations: Submit validation data