HPA008067

MTHFS antibody from Sigma-Aldrich
HsT19268
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008067
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008067, RRID:AB_1078882
Product name
Anti-MTHFS antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008067
Antibody type
Polyclonal
Antigen
5-Formyltetrahydrofolate cyclo-ligase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGL
GFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLA
LAFKEQICLQVPVNENDMKVDEVLYEDSSTA
Storage
-20C
Provider Type Product Number
- No reagents -