HPA008423

TMEM94 antibody from Atlas Antibodies
KIAA0195
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008423
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008423, RRID:AB_1852283
Product name
Anti-TMEM94
Provider product page
Atlas Antibodies - HPA008423
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PETVLFFSGKVEPPHSSHEDLTDGLSTRSFCHPEP
HERDALLAGSLNNTLHLSNEQERGDWPGEAPKPPE
PYSHHKAHGRSKHPSGSNTQPGMESDPYEAEDFVC
DYHLEML
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -