HPA008423

TMEM94 antibody from Sigma-Aldrich
KIAA0195
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008423
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008423, RRID:AB_1852283
Product name
Anti-KIAA0195 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008423
Antibody type
Polyclonal
Antigen
Uncharacterized protein KIAA0195 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PETVLFFSGKVEPPHSSHEDLTDGLSTRSFCHPEP
HERDALLAGSLNNTLHLSNEQERGDWPGEAPKPPE
PYSHHKAHGRSKHPSGSNTQPGMESDPYEAEDFVC
DYHLEML
Storage
-20C
Provider Type Product Number
- No reagents -