Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN183143 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Chloride Intracellular Channel 4 (CLIC4) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CLIC4 antibody: synthetic peptide directed towards the N terminal of human CLIC4
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus
- Host
- Rabbit
- Antigen sequence
LSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPF
SQRLF MILWLKGVVF- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Quantitative proteome analysis using isotope-coded affinity tags and mass spectrometry.
Quantitative proteomic analysis of myc-induced apoptosis: a direct role for Myc induction of the mitochondrial chloride ion channel, mtCLIC/CLIC4.
Shiio Y, Aebersold R
Nature protocols 2006;1(1):139-45
Nature protocols 2006;1(1):139-45
Quantitative proteomic analysis of myc-induced apoptosis: a direct role for Myc induction of the mitochondrial chloride ion channel, mtCLIC/CLIC4.
Shiio Y, Suh KS, Lee H, Yuspa SH, Eisenman RN, Aebersold R
The Journal of biological chemistry 2006 Feb 3;281(5):2750-6
The Journal of biological chemistry 2006 Feb 3;281(5):2750-6
No comments: Submit comment
No validations: Submit validation data