HPA008019

CLIC4 antibody from Sigma-Aldrich
CLIC4L, DKFZP566G223, H1, huH1, P64H1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008019
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008019, RRID:AB_1846946
Product name
Anti-CLIC4 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008019
Antibody type
Polyclonal
Antigen
Chloride intracellular channel protein 4 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
THPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKL
SPKHPESNTAGMDIFAKFSAYIKNSRPEANEALER
GLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRK
FLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPK
EMTGI
Storage
-20C
Provider Type Product Number
- No reagents -