HPA026899

TMEM190 antibody from Sigma-Aldrich
MDAC1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA026899
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA026899, RRID:AB_2204897
Product name
Anti-TMEM190 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA026899
Antibody type
Polyclonal
Antigen
Transmembrane protein 190 Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
FFYPWSCEGDIWDRESCGGQAAIDSPNLCLRLRCC
YRNGVCYHQRPDENV
Storage
-20C
Provider Type Product Number
- No reagents -