HPA008021

CTSE antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008021
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA008021, RRID:AB_1078405
Product name
Anti-CTSE antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA008021
Antibody type
Polyclonal
Antigen
Cathepsin E Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IQVGGTVMFCSEGCQAIVDTGTSLITGPSDKIKQL
QNAIGAAPVDGEYAVECANLNVMPDVTFTINGVPY
TLSPTAYTLLDFVDGMQFCSSGFQGLDIHPPAGPL
WILGDVFIRQF
Storage
-20C
Provider Type Product Number
- No reagents -