HPA027158

RNF146 antibody from Atlas Antibodies
dactylidin, dJ351K20.1, DKFZp434O1427
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA027158
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA027158, RRID:AB_10544936
Product name
Anti-RNF146
Provider product page
Atlas Antibodies - HPA027158
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IPEDFLDKPTLLSPEELKAASRGNGEYAWYYEGRN
GWWQYDERTSRELEDAFSKGKKNTEMLIAGFLYVA
DLEN
Isotype
IgG
Vial size (┬Ál)
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -