H00081847-A01

RNF146 antibody from Abnova Corporation
dactylidin, dJ351K20.1, DKFZp434O1427
No application information provided.

Antibody data

Product number
H00081847-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00081847-A01, RRID:AB_463500
Product name
RNF146 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00081847-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant RNF146.
Antigen sequence
MAGCGEIDHSINMLPTNRKANESCSNTAPSLTVPE
CAICLQTCVHPVSLPCKHVFCYLCVKGASWLGKRC
ALCRQEIPEDFLDKPTLLSPEELKAASRGNGEYAW
YYEGR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -