Explore
Validate
LearnAMAb91161
antibody from Atlas Antibodies
Targeting: LAMB3
BM600-125kDa, kalinin-140kDa, LAMNB1, nicein-125kDa
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [5]
Submit
Validation data
Reference
Comment
Report error
- Product number
- AMAb91161 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#AMAb91161, RRID:AB_2665826
- Product name
- Anti-LAMB3
- Antibody type
- Monoclonal
- Reactivity
- Human
- Host
- Mouse
- Conjugate
- Unconjugated
- Antigen sequence
KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQ
QLAEGASEQALSAQEGFERIKQKYAELKDRLGQSS
MLGEQGARIQSVKTEAEELFGETMEMMDRMKDMEL
ELLRGSQAIMLRSADLTGLEKRVEQ- Epitope
- Binds to an epitope located within the peptide sequence MTKQLGDFWTRMEEL as determined by overlapping synthetic peptides.
- Isotype
- IgG
- Antibody clone number
- CL3363
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Western blot analysis of purified human recombinant Laminin-332, Laminin-421, Laminin-511, Laminin-121 and Laminin-221.
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human duodenum shows immunoreactivity in basement membrane of glandular epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human prostate shows immunoreactivity in basement membrane of glandular epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human fallopian tube shows positivity in basement membrane of glandular epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human urinary bladder wall shows immunoreactivity in basement membrane of squamous epithelium.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human tonsil shows absence of immunoreactivity in lymphoid tissue (negative control).
