Explore
Validate
LearnH00003914-M01
antibody from Abnova Corporation
Targeting: LAMB3
BM600-125kDa, kalinin-140kDa, LAMNB1, nicein-125kDa
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003914-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003914-M01, RRID:AB_489774
- Product name
- LAMB3 monoclonal antibody (M01), clone 2G10
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant LAMB3.
- Antigen sequence
AEGASEQALSAQEGFERIKQKYAELKDRLGQSSML
GEQGARIQSVKTEAEELFGETMEMMDRMKDMELEL
LRGSQAIMLRSADLTGLEKRVEQIRDHINGRVLYY
ATC- Isotype
- IgG
- Antibody clone number
- 2G10
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Clinical significance of LAMB3 and COL7A1 mRNA in esophageal squamous cell carcinoma.
Kita Y, Mimori K, Tanaka F, Matsumoto T, Haraguchi N, Ishikawa K, Matsuzaki S, Fukuyoshi Y, Inoue H, Natsugoe S, Aikou T, Mori M
European journal of surgical oncology : the journal of the European Society of Surgical Oncology and the British Association of Surgical Oncology 2009 Jan;35(1):52-8
European journal of surgical oncology : the journal of the European Society of Surgical Oncology and the British Association of Surgical Oncology 2009 Jan;35(1):52-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- LAMB3 monoclonal antibody (M01), clone 2G10 Western Blot analysis of LAMB3 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged LAMB3 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to LAMB3 on A-431 cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
