HPA008069
antibody from Atlas Antibodies
Targeting: LAMB3
BM600-125kDa, kalinin-140kDa, LAMNB1, nicein-125kDa
Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA008069 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA008069, RRID:AB_1079228
- Product name
- Anti-LAMB3
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQ
QLAEGASEQALSAQEGFERIKQKYAELKDRLGQSS
MLGEQGARIQSVKTEAEELFGETMEMMDRMKDMEL
ELLRGSQAIMLRSADLTGLEKRVEQ- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Tumor suppressive microRNA-218 inhibits cancer cell migration and invasion by targeting focal adhesion pathways in cervical squamous cell carcinoma.
Tumor suppressive microRNA-218 inhibits cancer cell migration and invasion through targeting laminin-332 in head and neck squamous cell carcinoma.
Yamamoto N, Kinoshita T, Nohata N, Itesako T, Yoshino H, Enokida H, Nakagawa M, Shozu M, Seki N
International journal of oncology 2013 May;42(5):1523-32
International journal of oncology 2013 May;42(5):1523-32
Tumor suppressive microRNA-218 inhibits cancer cell migration and invasion through targeting laminin-332 in head and neck squamous cell carcinoma.
Kinoshita T, Hanazawa T, Nohata N, Kikkawa N, Enokida H, Yoshino H, Yamasaki T, Hidaka H, Nakagawa M, Okamoto Y, Seki N
Oncotarget 2012 Nov;3(11):1386-400
Oncotarget 2012 Nov;3(11):1386-400
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human stomach shows moderate cytoplasmic positivity in glandular cells.
- Sample type
- HUMAN