HPA008069

LAMB3 antibody from Atlas Antibodies
BM600-125kDa, kalinin-140kDa, LAMNB1, nicein-125kDa
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA008069
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA008069, RRID:AB_1079228
Product name
Anti-LAMB3
Provider product page
Atlas Antibodies - HPA008069
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQ
QLAEGASEQALSAQEGFERIKQKYAELKDRLGQSS
MLGEQGARIQSVKTEAEELFGETMEMMDRMKDMEL
ELLRGSQAIMLRSADLTGLEKRVEQ
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -