HPA008069

LAMB3 antibody from Sigma-Aldrich
BM600-125kDa, kalinin-140kDa, LAMNB1, nicein-125kDa
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008069
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008069, RRID:AB_1079228
Product name
Anti-LAMB3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008069
Antibody type
Polyclonal
Antigen
Laminin subunit beta-3 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLVTSMTKQLGDFWTRMEELRHQARQQGAEAVQAQ
QLAEGASEQALSAQEGFERIKQKYAELKDRLGQSS
MLGEQGARIQSVKTEAEELFGETMEMMDRMKDMEL
ELLRGSQAIMLRSADLTGLEKRVEQ
Storage
-20C
Provider Type Product Number
- No reagents -