HPA022913

LLGL2 antibody from Sigma-Aldrich
HGL, Hugl-2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA022913
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA022913, RRID:AB_1852930
Product name
Anti-LLGL2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA022913
Antibody type
Polyclonal
Antigen
Lethal recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSA
ETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQPG
LVMERALLSDERVLKEIQSTLEGDRGSGNWRSHRA
AVGCSLSNGGAE
Storage
-20C
Provider Type Product Number
- No reagents -