HPA020448

RBM45 antibody from Sigma-Aldrich
DRB1, FLJ44612
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020448
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020448, RRID:AB_1856133
Product name
Anti-RBM45 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020448
Antibody type
Polyclonal
Antigen
RNA-binding protein 45 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VDSLDEPPNSRIFLVISKYTPESVLRERFSPFGDI
QDIWVVRDKHTKESKGIAFVKFARSSQACRAMEEM
HGQCLGPNDTKPIKVFIAQSRSSGSHRDVEDEELT
RIFVMIPKSYTEE
Storage
-20C
Provider Type Product Number
- No reagents -