HPA007978

PTH1R antibody from Sigma-Aldrich
PTHR, PTHR1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007978
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007978, RRID:AB_1854967
Product name
Anti-PTH1R antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007978
Antibody type
Polyclonal
Antigen
Parathyroid hormone/parathyroid hormone-related peptide receptor Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGP
RVGLGLPLSPRLLPTATTNGHPQLPGHAKPGTPAL
ETLETTPPAMAAPKDDGFLNGSCSGLDEEASGPER
PPALLQ
Storage
-20C
Provider Type Product Number
- No reagents -