Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1108932 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SAP30 Binding Protein (SAP30BP) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SAP30BP antibody: synthetic peptide directed towards the C terminal of human SAP30B
- Description
- Purified using peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
WSEDSYYEALAKAQKIEMDKLEKAKKERTKIEFVT
GTKKGTTTNATSTTT- Epitope
- C-Term
- Vial size
- 50 μg
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references HTRP--an immediate-early gene product induced by HSV1 infection in human embryo fibroblasts, is involved in cellular co-repressors.
Li JF, Liu LD, Ma SH, Che YC, Wang LC, Dong CH, Zhao HL, Liao Y, Li QH
Journal of biochemistry 2004 Aug;136(2):169-76
Journal of biochemistry 2004 Aug;136(2):169-76
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human MCF-7; WB Suggested Anti-SAP30BP Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: MCF7 cell lysate. SAP30BP is supported by BioGPS gene expression data to be expressed in MCF7.; SAP30BP antibody - C-terminal region (AP42269PU-N) in Human MCF-7 cells using Western Blot