HPA007979

FKBP15 antibody from Sigma-Aldrich
FKBP133, KIAA0674, PPP1R76, WAFL
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007979
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007979, RRID:AB_1848615
Product name
Anti-FKBP15 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007979
Antibody type
Polyclonal
Antigen
FK506-binding protein 15 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENER
LKQEILEKSNRIEEQNDKISELIERNQRYVEQSNL
MMEKRNNSLQTATENTQARVLHAEQEKAKVTEELA
AATAQVSHLQLKMTAHQ
Storage
-20C
Provider Type Product Number
- No reagents -