Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA024168 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA024168, RRID:AB_1851629
- Product name
- Anti-IL12RB2
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
WKNLSVSEARGKILHYQVTLQELTGGKAMTQNITG
HTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIM
NLCEAGLLAPRQVSANSEGMDNILVTWQPPRKDPS
AV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Network-Based Assessment of Minimal Change Disease Identifies Glomerular Response to IL-7 and IL-12 Pathways Activation as Innovative Treatment Target
Eikrem Ø, Lillefosse B, Delaleu N, Strauss P, Osman T, Vikse B, Debiec H, Ronco P, Sekulic M, Koch E, Furriol J, Leh S, Marti H
Biomedicines 2023;11(1):226
Biomedicines 2023;11(1):226
No comments: Submit comment
No validations: Submit validation data