HPA024168

IL12RB2 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA024168
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA024168, RRID:AB_1851629
Product name
Anti-IL12RB2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA024168
Antibody type
Polyclonal
Antigen
Interleukin-12 receptor beta-2 chain Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
WKNLSVSEARGKILHYQVTLQELTGGKAMTQNITG
HTSWTTVIPRTGNWAVAVSAANSKGSSLPTRINIM
NLCEAGLLAPRQVSANSEGMDNILVTWQPPRKDPS
AV
Storage
-20C
Provider Type Product Number
- No reagents -