HPA020559

SERBP1 antibody from Sigma-Aldrich
CGI-55, CHD3IP, DKFZP564M2423, HABP4L, PAI-RBP1, PAIRBP1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA020559
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA020559, RRID:AB_1856701
Product name
Anti-SERBP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA020559
Antibody type
Polyclonal
Antigen
Plasminogen activator inhibitor 1 RNA-binding protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GHLQEGFGCVVTNRFDQLFDDESDPFEVLKAAENK
KKEAGGGGVGGPGAKSAAQAAAQTNSNAAGKQLRK
ESQKDRKNPLPPSVGVVDKKEETQPPVALKKEGIR
RVGRRPDQQLQGEGKIIDRRPERRPPRERRFE
Storage
-20C
Provider Type Product Number
- No reagents -