Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010181-M02 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010181-M02, RRID:AB_10554397
- Product name
- RBM5 monoclonal antibody (M02), clone 3G6
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant RBM5.
- Antigen sequence
GYHSDGDYGEHDYRHDISDERESKTIMLRGLPITI
TESDIREMMESFEGPQPADVRLMKRKTGVSRGFAF
VEFYHLQDATSWMEANQKKLVIQGKHIAMHYSNPR
PKFED- Isotype
- IgG
- Antibody clone number
- 3G6
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of RBM5 expression in transfected 293T cell line by RBM5 monoclonal antibody (M02), clone 3G6.Lane 1: RBM5 transfected lysate (Predicted MW: 61.5 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to RBM5 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol