HPA018011

RBM5 antibody from Sigma-Aldrich
H37, LUCA15
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018011
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018011, RRID:AB_1856135
Product name
Anti-RBM5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018011
Antibody type
Polyclonal
Antigen
RNA-binding protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DKRVSRTERSGRYGSIIDRDDRDERESRSRRRDSD
YKRSSDDRRGDRYDDYRDYDSPERERERRNSDRSE
DGYHSDGDYGEHDYRHDISDERESKTIMLRGLPIT
ITESDIREMMESFEGPQPADVRLMKRKTGVSRGFA
FVEFYHL
Storage
-20C
Provider Type Product Number
- No reagents -