HPA017335

RBM5 antibody from Atlas Antibodies
H37, LUCA-15, LUCA15
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017335
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017335, RRID:AB_1856134
Product name
Anti-RBM5
Provider product page
Atlas Antibodies - HPA017335
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
WSSTQSQSGEGGSVDYSYLQPGQDGYAQYAQYSQD
YQQFYQQQAGGLESDASSASGTAVTTTSAAVVSQS
PQLYNQTSNPPGSPTEEAQPSTSTSTQAPAASPTG
VVPGTKYAVPDTSTYQYDESSGYYY
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -