Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- Immunohistochemistry [4]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN1449871 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Zinc Finger Protein 71 (ZNF71) antibody
- Antibody type
- Polyclonal
- Antigen
- A synthetic peptide located within the following region of human ZNF71:
- Description
- Peptide immunoaffinity column
- Reactivity
- Human, Mouse, Rat, Bovine
- Host
- Rabbit
- Antigen sequence
RCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGK
TFSRNTNLTRHLRIH- Vial size
- 50 μg
- Concentration
- 1.0 mg/mL after reconstitution
- Storage
- Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or (in aliquots) at -20°C long term.
- Handling
- Avoid repeated freezing and thawing.
Submitted references Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
Suzuki Y, Yamashita R, Shirota M, Sakakibara Y, Chiba J, Mizushima-Sugano J, Nakai K, Sugano S
Genome research 2004 Sep;14(9):1711-8
Genome research 2004 Sep;14(9):1711-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human PANC1; WB Suggested Anti-ZNF71 Antibody Titration: 1 ug/ml. Positive Control: PANC1 cell lysate; ZNF71 antibody - middle region (AP44456PU-N) in Human PANC1 cells using Western Blot
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human uterus; Anti-ZNF71 antibody IHC staining of human uterus. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.; ZNF71 antibody - middle region (AP44456PU-N) in Human uterus cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human placenta; Anti-ZNF71 antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.; ZNF71 antibody - middle region (AP44456PU-N) in Human placenta cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human placenta; Anti-ZNF71 antibody IHC staining of human placenta. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.; ZNF71 antibody - middle region (AP44456PU-N) in Human placenta cells using Immunohistochemistry
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Human spleen; Anti-ZNF71 antibody IHC staining of human spleen. Immunohistochemistry of formalin-fixed, paraffin-embedded tissue after heat-induced antigen retrieval. Antibody concentration 5 ug/ml.; ZNF71 antibody - middle region (AP44456PU-N) in Human spleen cells using Immunohistochemistry