Antibody data

Product number
ABIN1449871
Provider
antibodies-online
Product name
anti-Zinc Finger Protein 71 (ZNF71) antibody
Provider product page
antibodies-online - ABIN1449871
Antibody type
Polyclonal
Antigen
A synthetic peptide located within the following region of human ZNF71:
Description
Peptide immunoaffinity column
Reactivity
Human, Mouse, Rat, Bovine
Host
Rabbit
Antigen sequence
RCGQCGKSFIKNSSLTVHQRIHTGEKPYRCGECGK
TFSRNTNLTRHLRIH
Vial size
50 μg
Concentration
1.0 mg/mL after reconstitution
Storage
Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or (in aliquots) at -20°C long term.
Handling
Avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -